PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g43680.3.p
Common NameBRADI_4g43680, LOC100824633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 785aa    MW: 87415.9 Da    PI: 7.0089
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g43680.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3858.7e-1184097801374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++ L++cA+av+++d + a++lL+++++++  +gd  qRla++f+++L+arla+++s+ y+ l +++t+    s+ l+a++l+  ++P+ ++
  Bradi4g43680.3.p 409 LRTILIHCAQAVAADDRRTANELLKQIKQHSKVNGDGSQRLAFCFAQGLEARLAGTGSQQYHRLVAKRTT---ASDMLKAYHLYLAACPFKRL 498
                       5789************************************************************999999...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       sh++ Nq+Il  ++++++vHiiDf+i  GlQWp+L++ L++R++gpp+lRiTg++ pe+g   +e++eetg+rLa++A++lgvpfe++  +a+
  Bradi4g43680.3.p 499 SHFLSNQTILSMTKNASTVHIIDFGIYFGLQWPCLIRRLSKREGGPPKLRITGIDVPEPGfrPTERIEETGQRLAEYADRLGVPFEYHG-IAS 590
                       ***********************************************************9*****************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+++ e+L+v ++E+++Vn+ ++  +l de+v+++s+r++vL+++++++P ++++   + +++ + F +rf eal ++salfd+lea++pr
  Bradi4g43680.3.p 591 KWETIRAEDLKVGKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVNPAIFIHGIVNGSYSVPFFITRFREALFHFSALFDMLEATVPR 683
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       ++++r+ +Er l+gre+ nv+aceg++r+er et+++W+ r  +aGF + pl+++++++ak  ++ ++ + + ++e+sg+l++gWk+r ++++
  Bradi4g43680.3.p 684 DDDQRRLIERDLFGREALNVIACEGSDRVERPETYKQWQVRNLRAGFVQSPLNQEIVAKAKVKVKDIYHKDFVIDEDSGWLLQGWKGRIIYAI 776
                       ********************************************************************888********************** PP

              GRAS 371 SaWr 374
                       + W+
  Bradi4g43680.3.p 777 TTWK 780
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.515383760IPR005202Transcription factor GRAS
PfamPF035143.0E-115409780IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
MASTPQPPRG DLAARLEAAA VAPPPAAAAQ DLAALGLAAA RSLRHRPPRH GGQMQSGPVE  60
HQSISGSLIH SMIQFCGAPK YFMFNDPQPV IPPQMAAQPN PSLPVATALS RATNNETDNP  120
EDWEFISDES LNYISRMLME EDIDEKVSMY QEESAMLRAT AKPFYDILGH KFPPSPDRNL  180
PWSLDSPGES SSSSHAQSLS SVITSCSSGA VEDSNQSRNI GHCEQLEAYR GLHGQSFQPV  240
VSPSSGVSDA AEALADPLIT NGRIPDNLFE SLPNWDFRRG VEEAQKFLPA SDKLVIDLEA  300
ADVSTSQVGK DISLNGSKPE VLNAKKNRQS EDLDLIEGRS IKQSAFCSDE PDWIEMFDGL  360
LRQTEQKATV LREKMRTEAS KNSQVTQTKA TTGVRTRGRK PTKNDVVDLR TILIHCAQAV  420
AADDRRTANE LLKQIKQHSK VNGDGSQRLA FCFAQGLEAR LAGTGSQQYH RLVAKRTTAS  480
DMLKAYHLYL AACPFKRLSH FLSNQTILSM TKNASTVHII DFGIYFGLQW PCLIRRLSKR  540
EGGPPKLRIT GIDVPEPGFR PTERIEETGQ RLAEYADRLG VPFEYHGIAS KWETIRAEDL  600
KVGKDEVVIV NCLYRFRNLI DETVAVDSPR NRVLNTIRQV NPAIFIHGIV NGSYSVPFFI  660
TRFREALFHF SALFDMLEAT VPRDDDQRRL IERDLFGREA LNVIACEGSD RVERPETYKQ  720
WQVRNLRAGF VQSPLNQEIV AKAKVKVKDI YHKDFVIDED SGWLLQGWKG RIIYAITTWK  780
PNNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-504137808375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577096.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010238778.10.0PREDICTED: scarecrow-like protein 9
TrEMBLI1IUS30.0I1IUS3_BRADI; Uncharacterized protein
STRINGBRADI4G43680.20.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein